PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10013084
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 342aa    MW: 38146.1 Da    PI: 10.7565
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10013084genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.11.7e-12181227148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W + Ed ll+++v  +G ++W+ I + +g gR +kqc++rw+++l
      Lus10013084 181 KGQWAPKEDGLLIQLVGVHGLKRWAVIGNIIG-GRLGKQCRERWHNHL 227
                      799*****************************.*************97 PP

2Myb_DNA-binding605.2e-19233275145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +W++eEde l++a+k++G++ W+ Ia++++ gRt++++k++w+
      Lus10013084 233 KEAWSKEEDEMLIKAHKEMGNR-WAEIAKRLP-GRTENSIKNHWN 275
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.556176227IPR017930Myb domain
SuperFamilySSF466895.99E-29178274IPR009057Homeodomain-like
SMARTSM007171.2E-10180229IPR001005SANT/Myb domain
PfamPF002497.2E-12181227IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-22182232IPR009057Homeodomain-like
CDDcd001674.79E-10184227No hitNo description
PROSITE profilePS5129426.143228282IPR017930Myb domain
SMARTSM007174.7E-19232280IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-23233280IPR009057Homeodomain-like
PfamPF002492.7E-17233275IPR001005SANT/Myb domain
CDDcd001672.00E-15235278No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MSSAFSFSAN KPPANGFLGF SNTANGFSSN SSLIAHNENK PPHIPVFLPP PPPYSSSWPI  60
DPIPTELQPH HYHFHYHHNI THLTLEINLF PTGRSDNHND RGGKDLNLLG KARTAQKQDD  120
KGKKIQTDDN KLGLTIPNHT SHGNEILFVD KEYRQIPSKV VSLKKRNEKT RPALNKQRII  180
KGQWAPKEDG LLIQLVGVHG LKRWAVIGNI IGGRLGKQCR ERWHNHLKPH IKKEAWSKEE  240
DEMLIKAHKE MGNRWAEIAK RLPGRTENSI KNHWNATKRR HFPSIRRNYR LAASSDDGAT  300
LKDYIDSVTS SSASRGVNKP TSAKASASAA AAAGHATRGH Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-411092804157MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-411092804157MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8841071e-88HQ884107.1 Linum usitatissimum clone Contig1200 microsatellite sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.17e-55myb domain protein 118